PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco010211.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 601aa    MW: 64439.3 Da    PI: 7.3703
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco010211.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-094314632254
                  SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  ++yp+ +++  LA+++gL+ +qV++WF N R +
  Aco010211.1 431 HPYPTDTDKHMLAAQTGLSRNQVSNWFINARVR 463
                  89*****************************88 PP

2BELL98.26.7e-32283352372
         BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                   e q+ k kLl ++eeV++rYkqy++q+q+v ssFe vagl sa+pY+slAlk+iS+hFr+Lk ai +q+
  Aco010211.1 283 PEFQQVKLKLLFMQEEVCRRYKQYHQQVQMVGSSFESVAGLSSATPYASLALKTISKHFRSLKSAILNQL 352
                  688999*************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-41201350IPR006563POX domain
PfamPF075261.7E-38206348IPR006563POX domain
PROSITE profilePS5007111.839404467IPR001356Homeobox domain
CDDcd000861.29E-12407468No hitNo description
SMARTSM003891.9E-9407471IPR001356Homeobox domain
SuperFamilySSF466893.85E-17409474IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-27410471IPR009057Homeodomain-like
PfamPF059201.7E-18424463IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence